PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G59780.2
Common NameATMYB59, ATMYB59-1, ATMYB59-2, ATMYB59-3, MYB59
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 214aa    MW: 24519.5 Da    PI: 8.9968
Description myb domain protein 59
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G59780.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66e-184287148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
      AT5G59780.2 42 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 87
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.646136IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.4E-102248IPR009057Homeodomain-like
SuperFamilySSF466891.38E-222292IPR009057Homeodomain-like
PROSITE profilePS5129427.8143791IPR017930Myb domain
SMARTSM007172.2E-174189IPR001005SANT/Myb domain
PfamPF002492.1E-164286IPR001005SANT/Myb domain
CDDcd001676.93E-134487No hitNo description
Gene3DG3DSA:1.10.10.605.8E-214988IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000003anatomywhole plant
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MGFCSESFRF EGGGRNIRIG LNRTGKSCRL RWVNYLHPGL KRGKMTPQEE RLVLELHAKW  60
GNRWSKIARK LPGRTDNEIK NYWRTHMRKK AQEKKRPMSP TSSSSNCCSS SMTTTTSQDT  120
GGSNGKMNQE CEDGYYSMDD IWREIDQSGA NVIKPVKDNY YSEQSCYLNF PPLASPTWES  180
SLESIWNMDA DESKMSSFAI DQFPLSFEHG SGRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-18239137105MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-18239191159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-18239191159MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-18239160128MYB TRANSFORMING PROTEIN
1mse_C1e-18239137105C-Myb DNA-Binding Domain
1msf_C1e-18239137105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.224280.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453620660.0
Genevisible247696_at0.0
Expression AtlasAT5G59780-
AtGenExpressAT5G59780-
ATTED-IIAT5G59780-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB59).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G59780.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G59780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0752530.0DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_851226.11e-161transcription factor MYB59
SwissprotQ4JL841e-147MYB59_ARATH; Transcription factor MYB59
TrEMBLD7MSI41e-140D7MSI4_ARALL; Putative uncharacterized protein
TrEMBLV4KWJ11e-140V4KWJ1_EUTSA; Uncharacterized protein
STRINGAT5G59780.31e-145(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Nikiforova V, et al.
    Transcriptome analysis of sulfur depletion in Arabidopsis thaliana: interlacing of biosynthetic pathways provides response specificity.
    Plant J., 2003. 33(4): p. 633-50
    [PMID:12609038]
  4. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  5. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  6. Stanley Kim H, et al.
    Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome.
    Plant J., 2005. 41(2): p. 212-20
    [PMID:15634198]
  7. He XJ, et al.
    AtNAC2, a transcription factor downstream of ethylene and auxin signaling pathways, is involved in salt stress response and lateral root development.
    Plant J., 2005. 44(6): p. 903-16
    [PMID:16359384]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Li J, et al.
    A subgroup of MYB transcription factor genes undergoes highly conserved alternative splicing in Arabidopsis and rice.
    J. Exp. Bot., 2006. 57(6): p. 1263-73
    [PMID:16531467]
  10. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  11. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  12. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Agudelo-Romero P, et al.
    Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus.
    Virol. J., 2008. 5: p. 92
    [PMID:18684336]
  15. Mu RL, et al.
    An R2R3-type transcription factor gene AtMYB59 regulates root growth and cell cycle progression in Arabidopsis.
    Cell Res., 2009. 19(11): p. 1291-304
    [PMID:19581938]
  16. Cominelli E,Tonelli C
    A new role for plant R2R3-MYB transcription factors in cell cycle regulation.
    Cell Res., 2009. 19(11): p. 1231-2
    [PMID:19881525]
  17. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]